PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.E00066.1.p
Common NameMIMGU_mgv1a006365mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family WRKY
Protein Properties Length: 448aa    MW: 49345.6 Da    PI: 8.5457
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.E00066.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.31.5e-33192248259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       +DgynWrKYGqK+vkgsefprsYY+Ct+++Cpvkkkvers   ++++ei+Y+g+Hnh+
  Migut.E00066.1.p 192 EDGYNWRKYGQKQVKGSEFPRSYYKCTHSNCPVKKKVERSL-KGQITEIIYKGQHNHP 248
                       7****************************************.9**************7 PP

2WRKY104.74.8e-33332390159
                       ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       ldDgy+WrKYGqK vkg+++prsYY+Ct++gC+v+k+ver+a+d k+v++tYeg+Hnh+
  Migut.E00066.1.p 332 LDDGYRWRKYGQKIVKGNPYPRSYYKCTMSGCTVRKHVERAASDAKAVITTYEGKHNHD 390
                       59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.1E-29184250IPR003657WRKY domain
PROSITE profilePS5081123.422186250IPR003657WRKY domain
SuperFamilySSF1182903.79E-26190250IPR003657WRKY domain
SMARTSM007746.5E-37191249IPR003657WRKY domain
PfamPF031062.8E-26192248IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.0E-36317392IPR003657WRKY domain
SuperFamilySSF1182902.88E-29324392IPR003657WRKY domain
PROSITE profilePS5081137.746327392IPR003657WRKY domain
SMARTSM007748.6E-38332391IPR003657WRKY domain
PfamPF031067.3E-26333390IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 448 aa     Download sequence    Send to blast
MADNKPPPPP PTITLPPRTS IDNFFTAGPG ASPGPMSLVS SFFAENEPEN DCRSFSQLLA  60
GAMSSPSAAP NGRHDFTAPA ESGGEGGGSG EFRFQQNRPA GLAVSQPPEM FTIPPGLSPA  120
CLLDSPGFFS SLQGSFGMSH QQILTQITSH AQAQVQRQMQ PLPYPNMKES SDISNPDQKS  180
QPHNLAVDKP SEDGYNWRKY GQKQVKGSEF PRSYYKCTHS NCPVKKKVER SLKGQITEII  240
YKGQHNHPLP NKRTKDNGNS NSVKEQVTHE HVSEYSSDSE EVGNAETRNE DEPESKRRNI  300
EVVQSSQQGG PSRSAVTEPR IIVQTTSEVD LLDDGYRWRK YGQKIVKGNP YPRSYYKCTM  360
SGCTVRKHVE RAASDAKAVI TTYEGKHNHD VPAAKTSSHS TANASSQLRH QNNPVINRPT  420
VNRGTEFQNR EQQQPVALLR FKEEQIS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-40192393878Probable WRKY transcription factor 4
2lex_A1e-40192393878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012855308.10.0PREDICTED: probable WRKY transcription factor 3
SwissprotQ9ZQ701e-152WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBLA0A022Q3280.0A0A022Q328_ERYGU; Uncharacterized protein
STRINGVIT_14s0108g01280.t011e-171(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41072445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.11e-149WRKY DNA-binding protein 3